PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KDD74079.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales
Family Nin-like
Protein Properties Length: 168aa    MW: 17518.8 Da    PI: 8.2215
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KDD74079.1genomeUBCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK50.54.1e-1614461749
      RWP-RK 17 pikdAAkeLgvclTvLKriCRqyGIkRWPhRki 49
                p  +A+ eLgv+lT+LKr CR+yG++RWP+Rk 
  KDD74079.1 14 PTDKACAELGVGLTILKRLCRRYGLARWPYRKH 46
                5679***************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.037169IPR003035RWP-RK domain
PfamPF020421.3E-121547IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MPAGDCRTVA SGPPTDKACA ELGVGLTILK RLCRRYGLAR WPYRKHCKLR RLASERGEDP  60
ELVITSADLV PSLAAYSSHS TPPATPPSPG GSLNLLLHAI DCEEAGLSRP SSRGSDAGSV  120
PGQAGGARSP GLEHKRGRET EVVESAEGPG LDPEPARKAA RLSPPEPG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A059LJ781e-115A0A059LJ78_9CHLO; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP841650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-08RWP-RK domain-containing protein